Anti RUFY1 pAb (ATL-HPA057614)

Atlas Antibodies

SKU: ATL-HPA057614-25

• 

Protein Description: RUN and FYVE domain containing 1
Gene Name: RUFY1
Alternative Gene Name: FLJ22251, RABIP4, ZFYVE12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020375: 85%, ENSRNOG00000003536: 84%
Entrez Gene ID: 80230
Uniprot ID: Q96T51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL
• Gene Sequence: NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL
• Gene ID - Mouse: ENSMUSG00000020375
• Gene ID - Rat: ENSRNOG00000003536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.