Anti RUFY1 pAb (ATL-HPA057614)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057614-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RUFY1
Alternative Gene Name: FLJ22251, RABIP4, ZFYVE12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020375: 85%, ENSRNOG00000003536: 84%
Entrez Gene ID: 80230
Uniprot ID: Q96T51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL |
| Gene Sequence | NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL |
| Gene ID - Mouse | ENSMUSG00000020375 |
| Gene ID - Rat | ENSRNOG00000003536 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RUFY1 pAb (ATL-HPA057614) | |
| Datasheet | Anti RUFY1 pAb (ATL-HPA057614) Datasheet (External Link) |
| Vendor Page | Anti RUFY1 pAb (ATL-HPA057614) at Atlas Antibodies |
| Documents & Links for Anti RUFY1 pAb (ATL-HPA057614) | |
| Datasheet | Anti RUFY1 pAb (ATL-HPA057614) Datasheet (External Link) |
| Vendor Page | Anti RUFY1 pAb (ATL-HPA057614) |