Anti RUBCN pAb (ATL-HPA054497)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054497-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RUBCN
Alternative Gene Name: KIAA0226, rubicon, rundataxin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035629: 64%, ENSRNOG00000059880: 64%
Entrez Gene ID: 9711
Uniprot ID: Q92622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS |
Gene Sequence | RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS |
Gene ID - Mouse | ENSMUSG00000035629 |
Gene ID - Rat | ENSRNOG00000059880 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RUBCN pAb (ATL-HPA054497) | |
Datasheet | Anti RUBCN pAb (ATL-HPA054497) Datasheet (External Link) |
Vendor Page | Anti RUBCN pAb (ATL-HPA054497) at Atlas Antibodies |
Documents & Links for Anti RUBCN pAb (ATL-HPA054497) | |
Datasheet | Anti RUBCN pAb (ATL-HPA054497) Datasheet (External Link) |
Vendor Page | Anti RUBCN pAb (ATL-HPA054497) |