Anti RTP4 pAb (ATL-HPA071189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071189-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040040: 32%, ENSRNOG00000009278: 32%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP |
| Gene Sequence | GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP |
| Gene ID - Mouse | ENSMUSG00000040040 |
| Gene ID - Rat | ENSRNOG00000009278 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RTP4 pAb (ATL-HPA071189) | |
| Datasheet | Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link) |
| Vendor Page | Anti RTP4 pAb (ATL-HPA071189) at Atlas Antibodies |
| Documents & Links for Anti RTP4 pAb (ATL-HPA071189) | |
| Datasheet | Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link) |
| Vendor Page | Anti RTP4 pAb (ATL-HPA071189) |