Anti RTP4 pAb (ATL-HPA064887)

Atlas Antibodies

Catalog No.: ATL-HPA064887-25

Protein Description: receptor (chemosensory) transporter protein 4
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066319: 46%, ENSRNOG00000028895: 48%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG
• Gene Sequence: CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG
• Gene ID - Mouse: ENSMUSG00000066319
• Gene ID - Rat: ENSRNOG00000028895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.