Anti RTL1 pAb (ATL-HPA077601)

Atlas Antibodies

Catalog No.:
ATL-HPA077601-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: retrotransposon Gag like 1
Gene Name: RTL1
Alternative Gene Name: HUR1, Mar1, MART1, PEG11, SIRH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085925: 48%,
Entrez Gene ID: 388015
Uniprot ID: A6NKG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR
Gene Sequence DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR
Gene ID - Mouse ENSMUSG00000085925
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTL1 pAb (ATL-HPA077601)
Datasheet Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link)
Vendor Page Anti RTL1 pAb (ATL-HPA077601) at Atlas Antibodies

Documents & Links for Anti RTL1 pAb (ATL-HPA077601)
Datasheet Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link)
Vendor Page Anti RTL1 pAb (ATL-HPA077601)