Anti RTL1 pAb (ATL-HPA077601)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077601-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RTL1
Alternative Gene Name: HUR1, Mar1, MART1, PEG11, SIRH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085925: 48%,
Entrez Gene ID: 388015
Uniprot ID: A6NKG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR |
| Gene Sequence | DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR |
| Gene ID - Mouse | ENSMUSG00000085925 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RTL1 pAb (ATL-HPA077601) | |
| Datasheet | Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link) |
| Vendor Page | Anti RTL1 pAb (ATL-HPA077601) at Atlas Antibodies |
| Documents & Links for Anti RTL1 pAb (ATL-HPA077601) | |
| Datasheet | Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link) |
| Vendor Page | Anti RTL1 pAb (ATL-HPA077601) |