Anti RTL1 pAb (ATL-HPA077601)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077601-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RTL1
Alternative Gene Name: HUR1, Mar1, MART1, PEG11, SIRH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085925: 48%,
Entrez Gene ID: 388015
Uniprot ID: A6NKG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR |
Gene Sequence | DRLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASRGFPRDPSTESGEEENEEQDELNEQILR |
Gene ID - Mouse | ENSMUSG00000085925 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RTL1 pAb (ATL-HPA077601) | |
Datasheet | Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link) |
Vendor Page | Anti RTL1 pAb (ATL-HPA077601) at Atlas Antibodies |
Documents & Links for Anti RTL1 pAb (ATL-HPA077601) | |
Datasheet | Anti RTL1 pAb (ATL-HPA077601) Datasheet (External Link) |
Vendor Page | Anti RTL1 pAb (ATL-HPA077601) |