Anti RTFDC1 pAb (ATL-HPA053986)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053986-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: RTFDC1
Alternative Gene Name: C20orf43, CDAO5, HSPC164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027502: 95%, ENSRNOG00000005083: 95%
Entrez Gene ID: 51507
Uniprot ID: Q9BY42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEDDVIVLNGTKEDVDVLK |
Gene Sequence | AWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEDDVIVLNGTKEDVDVLK |
Gene ID - Mouse | ENSMUSG00000027502 |
Gene ID - Rat | ENSRNOG00000005083 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RTFDC1 pAb (ATL-HPA053986) | |
Datasheet | Anti RTFDC1 pAb (ATL-HPA053986) Datasheet (External Link) |
Vendor Page | Anti RTFDC1 pAb (ATL-HPA053986) at Atlas Antibodies |
Documents & Links for Anti RTFDC1 pAb (ATL-HPA053986) | |
Datasheet | Anti RTFDC1 pAb (ATL-HPA053986) Datasheet (External Link) |
Vendor Page | Anti RTFDC1 pAb (ATL-HPA053986) |