Anti RTEL1 pAb (ATL-HPA067329)

Atlas Antibodies

SKU:
ATL-HPA067329-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: regulator of telomere elongation helicase 1
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 53%, ENSRNOG00000027513: 60%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG
Gene Sequence PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG
Gene ID - Mouse ENSMUSG00000038685
Gene ID - Rat ENSRNOG00000027513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RTEL1 pAb (ATL-HPA067329)
Datasheet Anti RTEL1 pAb (ATL-HPA067329) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA067329) at Atlas Antibodies

Documents & Links for Anti RTEL1 pAb (ATL-HPA067329)
Datasheet Anti RTEL1 pAb (ATL-HPA067329) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA067329)