Anti RTCA pAb (ATL-HPA027982 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027982-100

Protein Description: RNA 3'-terminal phosphate cyclase
Gene Name: RTCA
Alternative Gene Name: RPC, RTC1, RTCD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000339: 89%, ENSRNOG00000014575: 90%
Entrez Gene ID: 8634
Uniprot ID: O00442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
• Gene Sequence: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
• Gene ID - Mouse: ENSMUSG00000000339
• Gene ID - Rat: ENSRNOG00000014575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RTCA pAb (ATL-HPA027982 w/enhanced validation) – 1 Found

Song, Yuanquan; Sretavan, David; Salegio, Ernesto A; Berg, Jim; Huang, Xi; Cheng, Tong; Xiong, Xin; Meltzer, Shan; Han, Chun; Nguyen, Trong-Tuong; Bresnahan, Jacqueline C; Beattie, Michael S; Jan, Lily Yeh; Jan, Yuh Nung. Regulation of axon regeneration by the RNA repair and splicing pathway. Nature Neuroscience. 2015;18(6):817-25.