Anti RSRP1 pAb (ATL-HPA067651)

Atlas Antibodies

Catalog No.:
ATL-HPA067651-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: arginine/serine-rich protein 1
Gene Name: RSRP1
Alternative Gene Name: C1orf63, DJ465N24.2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037266: 65%, ENSRNOG00000017309: 73%
Entrez Gene ID: 57035
Uniprot ID: Q9BUV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRT
Gene Sequence RSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRT
Gene ID - Mouse ENSMUSG00000037266
Gene ID - Rat ENSRNOG00000017309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSRP1 pAb (ATL-HPA067651)
Datasheet Anti RSRP1 pAb (ATL-HPA067651) Datasheet (External Link)
Vendor Page Anti RSRP1 pAb (ATL-HPA067651) at Atlas Antibodies

Documents & Links for Anti RSRP1 pAb (ATL-HPA067651)
Datasheet Anti RSRP1 pAb (ATL-HPA067651) Datasheet (External Link)
Vendor Page Anti RSRP1 pAb (ATL-HPA067651)