Anti RSRP1 pAb (ATL-HPA067651)
Atlas Antibodies
- SKU:
- ATL-HPA067651-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RSRP1
Alternative Gene Name: C1orf63, DJ465N24.2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037266: 65%, ENSRNOG00000017309: 73%
Entrez Gene ID: 57035
Uniprot ID: Q9BUV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRT |
Gene Sequence | RSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRT |
Gene ID - Mouse | ENSMUSG00000037266 |
Gene ID - Rat | ENSRNOG00000017309 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RSRP1 pAb (ATL-HPA067651) | |
Datasheet | Anti RSRP1 pAb (ATL-HPA067651) Datasheet (External Link) |
Vendor Page | Anti RSRP1 pAb (ATL-HPA067651) at Atlas Antibodies |
Documents & Links for Anti RSRP1 pAb (ATL-HPA067651) | |
Datasheet | Anti RSRP1 pAb (ATL-HPA067651) Datasheet (External Link) |
Vendor Page | Anti RSRP1 pAb (ATL-HPA067651) |