Anti RSRC2 pAb (ATL-HPA048183)

Atlas Antibodies

Catalog No.:
ATL-HPA048183-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: arginine/serine-rich coiled-coil 2
Gene Name: RSRC2
Alternative Gene Name: FLJ11021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029422: 98%, ENSRNOG00000001238: 98%
Entrez Gene ID: 65117
Uniprot ID: Q7L4I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARRLERAKKLQEQREKEMVEKQKQQEIAAAAATGGSVLNVAALLASGTQVTPQIAMAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQG
Gene Sequence ARRLERAKKLQEQREKEMVEKQKQQEIAAAAATGGSVLNVAALLASGTQVTPQIAMAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQG
Gene ID - Mouse ENSMUSG00000029422
Gene ID - Rat ENSRNOG00000001238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSRC2 pAb (ATL-HPA048183)
Datasheet Anti RSRC2 pAb (ATL-HPA048183) Datasheet (External Link)
Vendor Page Anti RSRC2 pAb (ATL-HPA048183) at Atlas Antibodies

Documents & Links for Anti RSRC2 pAb (ATL-HPA048183)
Datasheet Anti RSRC2 pAb (ATL-HPA048183) Datasheet (External Link)
Vendor Page Anti RSRC2 pAb (ATL-HPA048183)