Anti RSRC2 pAb (ATL-HPA048183)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048183-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RSRC2
Alternative Gene Name: FLJ11021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029422: 98%, ENSRNOG00000001238: 98%
Entrez Gene ID: 65117
Uniprot ID: Q7L4I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ARRLERAKKLQEQREKEMVEKQKQQEIAAAAATGGSVLNVAALLASGTQVTPQIAMAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQG |
| Gene Sequence | ARRLERAKKLQEQREKEMVEKQKQQEIAAAAATGGSVLNVAALLASGTQVTPQIAMAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQG |
| Gene ID - Mouse | ENSMUSG00000029422 |
| Gene ID - Rat | ENSRNOG00000001238 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSRC2 pAb (ATL-HPA048183) | |
| Datasheet | Anti RSRC2 pAb (ATL-HPA048183) Datasheet (External Link) |
| Vendor Page | Anti RSRC2 pAb (ATL-HPA048183) at Atlas Antibodies |
| Documents & Links for Anti RSRC2 pAb (ATL-HPA048183) | |
| Datasheet | Anti RSRC2 pAb (ATL-HPA048183) Datasheet (External Link) |
| Vendor Page | Anti RSRC2 pAb (ATL-HPA048183) |