Anti RSPH10B pAb (ATL-HPA049182)

Atlas Antibodies

Catalog No.:
ATL-HPA049182-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: radial spoke head 10 homolog B (Chlamydomonas)
Gene Name: RSPH10B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075569: 93%, ENSRNOG00000001036: 94%
Entrez Gene ID: 222967
Uniprot ID: P0C881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQN
Gene Sequence EGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQN
Gene ID - Mouse ENSMUSG00000075569
Gene ID - Rat ENSRNOG00000001036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSPH10B pAb (ATL-HPA049182)
Datasheet Anti RSPH10B pAb (ATL-HPA049182) Datasheet (External Link)
Vendor Page Anti RSPH10B pAb (ATL-HPA049182) at Atlas Antibodies

Documents & Links for Anti RSPH10B pAb (ATL-HPA049182)
Datasheet Anti RSPH10B pAb (ATL-HPA049182) Datasheet (External Link)
Vendor Page Anti RSPH10B pAb (ATL-HPA049182)