Anti RSC1A1 pAb (ATL-HPA028676)

Atlas Antibodies

Catalog No.: ATL-HPA028676-25

Protein Description: regulatory solute carrier protein, family 1, member 1
Gene Name: RSC1A1
Alternative Gene Name: RS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078515: 44%, ENSRNOG00000012274: 44%
Entrez Gene ID: 6248
Uniprot ID: Q92681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGVEISPKLLAGEEDALNQTSEQTKSLSSNF
• Gene Sequence: KLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGVEISPKLLAGEEDALNQTSEQTKSLSSNF
• Gene ID - Mouse: ENSMUSG00000078515
• Gene ID - Rat: ENSRNOG00000012274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.