Anti RSBN1 pAb (ATL-HPA049484)

Atlas Antibodies

Catalog No.:
ATL-HPA049484-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: round spermatid basic protein 1
Gene Name: RSBN1
Alternative Gene Name: FLJ11220, ROSBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044098: 88%, ENSRNOG00000019671: 87%
Entrez Gene ID: 54665
Uniprot ID: Q5VWQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKA
Gene Sequence PSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKA
Gene ID - Mouse ENSMUSG00000044098
Gene ID - Rat ENSRNOG00000019671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSBN1 pAb (ATL-HPA049484)
Datasheet Anti RSBN1 pAb (ATL-HPA049484) Datasheet (External Link)
Vendor Page Anti RSBN1 pAb (ATL-HPA049484) at Atlas Antibodies

Documents & Links for Anti RSBN1 pAb (ATL-HPA049484)
Datasheet Anti RSBN1 pAb (ATL-HPA049484) Datasheet (External Link)
Vendor Page Anti RSBN1 pAb (ATL-HPA049484)