Anti RSBN1 pAb (ATL-HPA049484)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049484-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RSBN1
Alternative Gene Name: FLJ11220, ROSBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044098: 88%, ENSRNOG00000019671: 87%
Entrez Gene ID: 54665
Uniprot ID: Q5VWQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKA |
Gene Sequence | PSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKA |
Gene ID - Mouse | ENSMUSG00000044098 |
Gene ID - Rat | ENSRNOG00000019671 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RSBN1 pAb (ATL-HPA049484) | |
Datasheet | Anti RSBN1 pAb (ATL-HPA049484) Datasheet (External Link) |
Vendor Page | Anti RSBN1 pAb (ATL-HPA049484) at Atlas Antibodies |
Documents & Links for Anti RSBN1 pAb (ATL-HPA049484) | |
Datasheet | Anti RSBN1 pAb (ATL-HPA049484) Datasheet (External Link) |
Vendor Page | Anti RSBN1 pAb (ATL-HPA049484) |