Anti RSAD2 pAb (ATL-HPA049409)

Atlas Antibodies

Catalog No.:
ATL-HPA049409-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: radical S-adenosyl methionine domain containing 2
Gene Name: RSAD2
Alternative Gene Name: cig5, vig1, viperin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020641: 91%, ENSRNOG00000007539: 91%
Entrez Gene ID: 91543
Uniprot ID: Q8WXG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL
Gene Sequence YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL
Gene ID - Mouse ENSMUSG00000020641
Gene ID - Rat ENSRNOG00000007539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSAD2 pAb (ATL-HPA049409)
Datasheet Anti RSAD2 pAb (ATL-HPA049409) Datasheet (External Link)
Vendor Page Anti RSAD2 pAb (ATL-HPA049409) at Atlas Antibodies

Documents & Links for Anti RSAD2 pAb (ATL-HPA049409)
Datasheet Anti RSAD2 pAb (ATL-HPA049409) Datasheet (External Link)
Vendor Page Anti RSAD2 pAb (ATL-HPA049409)