Anti RSAD2 pAb (ATL-HPA049409)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049409-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RSAD2
Alternative Gene Name: cig5, vig1, viperin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020641: 91%, ENSRNOG00000007539: 91%
Entrez Gene ID: 91543
Uniprot ID: Q8WXG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL |
Gene Sequence | YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL |
Gene ID - Mouse | ENSMUSG00000020641 |
Gene ID - Rat | ENSRNOG00000007539 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RSAD2 pAb (ATL-HPA049409) | |
Datasheet | Anti RSAD2 pAb (ATL-HPA049409) Datasheet (External Link) |
Vendor Page | Anti RSAD2 pAb (ATL-HPA049409) at Atlas Antibodies |
Documents & Links for Anti RSAD2 pAb (ATL-HPA049409) | |
Datasheet | Anti RSAD2 pAb (ATL-HPA049409) Datasheet (External Link) |
Vendor Page | Anti RSAD2 pAb (ATL-HPA049409) |