Anti RS1 pAb (ATL-HPA059546)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059546-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RS1
Alternative Gene Name: RS, XLRS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031293: 97%, ENSRNOG00000030434: 98%
Entrez Gene ID: 6247
Uniprot ID: O15537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE |
Gene Sequence | SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE |
Gene ID - Mouse | ENSMUSG00000031293 |
Gene ID - Rat | ENSRNOG00000030434 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RS1 pAb (ATL-HPA059546) | |
Datasheet | Anti RS1 pAb (ATL-HPA059546) Datasheet (External Link) |
Vendor Page | Anti RS1 pAb (ATL-HPA059546) at Atlas Antibodies |
Documents & Links for Anti RS1 pAb (ATL-HPA059546) | |
Datasheet | Anti RS1 pAb (ATL-HPA059546) Datasheet (External Link) |
Vendor Page | Anti RS1 pAb (ATL-HPA059546) |