Anti RS1 pAb (ATL-HPA059546)

Atlas Antibodies

Catalog No.:
ATL-HPA059546-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: retinoschisin 1
Gene Name: RS1
Alternative Gene Name: RS, XLRS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031293: 97%, ENSRNOG00000030434: 98%
Entrez Gene ID: 6247
Uniprot ID: O15537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE
Gene Sequence SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE
Gene ID - Mouse ENSMUSG00000031293
Gene ID - Rat ENSRNOG00000030434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RS1 pAb (ATL-HPA059546)
Datasheet Anti RS1 pAb (ATL-HPA059546) Datasheet (External Link)
Vendor Page Anti RS1 pAb (ATL-HPA059546) at Atlas Antibodies

Documents & Links for Anti RS1 pAb (ATL-HPA059546)
Datasheet Anti RS1 pAb (ATL-HPA059546) Datasheet (External Link)
Vendor Page Anti RS1 pAb (ATL-HPA059546)