Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA060937-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
Gene Name: RRS1
Alternative Gene Name: KIAA0112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061024: 91%, ENSRNOG00000007240: 88%
Entrez Gene ID: 23212
Uniprot ID: Q15050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ
Gene Sequence EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ
Gene ID - Mouse ENSMUSG00000061024
Gene ID - Rat ENSRNOG00000007240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation)
Datasheet Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation)
Datasheet Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RRS1 pAb (ATL-HPA060937 w/enhanced validation)