Anti RRP1B pAb (ATL-HPA017893 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017893-25

Protein Description: ribosomal RNA processing 1B
Gene Name: RRP1B
Alternative Gene Name: KIAA0179, Nnp1, PPP1R136, RRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058392: 34%, ENSRNOG00000001194: 47%
Entrez Gene ID: 23076
Uniprot ID: Q14684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG
• Gene Sequence: SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG
• Gene ID - Mouse: ENSMUSG00000058392
• Gene ID - Rat: ENSRNOG00000001194
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RRP1B pAb (ATL-HPA017893 w/enhanced validation) – 2 Found

Lee, M; Dworkin, A M; Gildea, D; Trivedi, N S; Moorhead, G B; Crawford, N P S. RRP1B is a metastasis modifier that regulates the expression of alternative mRNA isoforms through interactions with SRSF1. Oncogene. 2014;33(14):1818-27. 

Alsarraj, Jude; Faraji, Farhoud; Geiger, Thomas R; Mattaini, Katherine R; Williams, Mia; Wu, Josephine; Ha, Ngoc-Han; Merlino, Tyler; Walker, Renard C; Bosley, Allen D; Xiao, Zhen; Andresson, Thorkell; Esposito, Dominic; Smithers, Nicholas; Lugo, Dave; Prinjha, Rab; Day, Anup; Crawford, Nigel P S; Ozato, Keiko; Gardner, Kevin; Hunter, Kent W. BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane. Plos One. 8(11):e80746.