Anti RRP15 pAb (ATL-HPA024639)

Atlas Antibodies

Catalog No.: ATL-HPA024639-25

Protein Description: ribosomal RNA processing 15 homolog (S. cerevisiae)
Gene Name: RRP15
Alternative Gene Name: CGI-115, KIAA0507
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001305: 61%, ENSRNOG00000002450: 54%
Entrez Gene ID: 51018
Uniprot ID: Q9Y3B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
• Gene Sequence: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
• Gene ID - Mouse: ENSMUSG00000001305
• Gene ID - Rat: ENSRNOG00000002450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.