Anti RRN3 pAb (ATL-HPA049837)

Atlas Antibodies

Catalog No.:
ATL-HPA049837-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Gene Name: RRN3
Alternative Gene Name: DKFZp566E104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022682: 85%, ENSRNOG00000003326: 85%
Entrez Gene ID: 54700
Uniprot ID: Q9NYV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Gene Sequence KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Gene ID - Mouse ENSMUSG00000022682
Gene ID - Rat ENSRNOG00000003326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRN3 pAb (ATL-HPA049837)
Datasheet Anti RRN3 pAb (ATL-HPA049837) Datasheet (External Link)
Vendor Page Anti RRN3 pAb (ATL-HPA049837) at Atlas Antibodies

Documents & Links for Anti RRN3 pAb (ATL-HPA049837)
Datasheet Anti RRN3 pAb (ATL-HPA049837) Datasheet (External Link)
Vendor Page Anti RRN3 pAb (ATL-HPA049837)
Citations for Anti RRN3 pAb (ATL-HPA049837) – 2 Found
Rossetti, Stefano; Wierzbicki, Andrzej J; Sacchi, Nicoletta. Mammary epithelial morphogenesis and early breast cancer. Evidence of involvement of basal components of the RNA Polymerase I transcription machinery. Cell Cycle (Georgetown, Tex.). 2016;15(18):2515-26.  PubMed
Ide, Satoru; Imai, Ryosuke; Ochi, Hiroko; Maeshima, Kazuhiro. Transcriptional suppression of ribosomal DNA with phase separation. Science Advances. 2020;6(42)  PubMed