Anti RRN3 pAb (ATL-HPA049837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049837-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RRN3
Alternative Gene Name: DKFZp566E104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022682: 85%, ENSRNOG00000003326: 85%
Entrez Gene ID: 54700
Uniprot ID: Q9NYV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV |
Gene Sequence | KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV |
Gene ID - Mouse | ENSMUSG00000022682 |
Gene ID - Rat | ENSRNOG00000003326 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RRN3 pAb (ATL-HPA049837) | |
Datasheet | Anti RRN3 pAb (ATL-HPA049837) Datasheet (External Link) |
Vendor Page | Anti RRN3 pAb (ATL-HPA049837) at Atlas Antibodies |
Documents & Links for Anti RRN3 pAb (ATL-HPA049837) | |
Datasheet | Anti RRN3 pAb (ATL-HPA049837) Datasheet (External Link) |
Vendor Page | Anti RRN3 pAb (ATL-HPA049837) |
Citations for Anti RRN3 pAb (ATL-HPA049837) – 2 Found |
Rossetti, Stefano; Wierzbicki, Andrzej J; Sacchi, Nicoletta. Mammary epithelial morphogenesis and early breast cancer. Evidence of involvement of basal components of the RNA Polymerase I transcription machinery. Cell Cycle (Georgetown, Tex.). 2016;15(18):2515-26. PubMed |
Ide, Satoru; Imai, Ryosuke; Ochi, Hiroko; Maeshima, Kazuhiro. Transcriptional suppression of ribosomal DNA with phase separation. Science Advances. 2020;6(42) PubMed |