Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056994-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RRM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020649: 72%, ENSRNOG00000054286: 68%
Entrez Gene ID: 6241
Uniprot ID: P31350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE |
| Gene Sequence | LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE |
| Gene ID - Mouse | ENSMUSG00000020649 |
| Gene ID - Rat | ENSRNOG00000054286 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) | |
| Datasheet | Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) | |
| Datasheet | Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) |
| Citations for Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) – 2 Found |
| Ly, Tony; Whigham, Arlene; Clarke, Rosemary; Brenes-Murillo, Alejandro J; Estes, Brett; Madhessian, Diana; Lundberg, Emma; Wadsworth, Patricia; Lamond, Angus I. Proteomic analysis of cell cycle progression in asynchronous cultures, including mitotic subphases, using PRIMMUS. Elife. 2017;6( 29052541) PubMed |
| Cheng, Wei-Chung; Chang, Chun-Yu; Lo, Chia-Chien; Hsieh, Chih-Ying; Kuo, Ting-Ting; Tseng, Guan-Chin; Wong, Sze-Ching; Chiang, Shu-Fen; Huang, Kevin Chih-Yang; Lai, Liang-Chuan; Lu, Tzu-Pin; Chao, K S Clifford; Sher, Yuh-Pyng. Identification of theranostic factors for patients developing metastasis after surgery for early-stage lung adenocarcinoma. Theranostics. 11(8):3661-3675. PubMed |