Anti RRAS pAb (ATL-HPA060364)

Atlas Antibodies

Catalog No.:
ATL-HPA060364-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: related RAS viral (r-ras) oncogene homolog
Gene Name: RRAS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038387: 80%, ENSRNOG00000037247: 80%
Entrez Gene ID: 6237
Uniprot ID: P10301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LESQRQVPRSEASAFGASHHVAYFEASAKL
Gene Sequence LESQRQVPRSEASAFGASHHVAYFEASAKL
Gene ID - Mouse ENSMUSG00000038387
Gene ID - Rat ENSRNOG00000037247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRAS pAb (ATL-HPA060364)
Datasheet Anti RRAS pAb (ATL-HPA060364) Datasheet (External Link)
Vendor Page Anti RRAS pAb (ATL-HPA060364) at Atlas Antibodies

Documents & Links for Anti RRAS pAb (ATL-HPA060364)
Datasheet Anti RRAS pAb (ATL-HPA060364) Datasheet (External Link)
Vendor Page Anti RRAS pAb (ATL-HPA060364)