Anti RRAGC pAb (ATL-HPA055489)

Atlas Antibodies

Catalog No.: ATL-HPA055489-25

Protein Description: Ras-related GTP binding C
Gene Name: RRAGC
Alternative Gene Name: FLJ13311, GTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028646: 100%, ENSRNOG00000017426: 100%
Entrez Gene ID: 64121
Uniprot ID: Q9HB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEE
• Gene Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEE
• Gene ID - Mouse: ENSMUSG00000028646
• Gene ID - Rat: ENSRNOG00000017426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.