Anti RRAGC pAb (ATL-HPA055489)

Atlas Antibodies

Catalog No.:
ATL-HPA055489-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras-related GTP binding C
Gene Name: RRAGC
Alternative Gene Name: FLJ13311, GTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028646: 100%, ENSRNOG00000017426: 100%
Entrez Gene ID: 64121
Uniprot ID: Q9HB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEE
Gene Sequence MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEE
Gene ID - Mouse ENSMUSG00000028646
Gene ID - Rat ENSRNOG00000017426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRAGC pAb (ATL-HPA055489)
Datasheet Anti RRAGC pAb (ATL-HPA055489) Datasheet (External Link)
Vendor Page Anti RRAGC pAb (ATL-HPA055489) at Atlas Antibodies

Documents & Links for Anti RRAGC pAb (ATL-HPA055489)
Datasheet Anti RRAGC pAb (ATL-HPA055489) Datasheet (External Link)
Vendor Page Anti RRAGC pAb (ATL-HPA055489)