Anti RRAGA pAb (ATL-HPA003734)

Atlas Antibodies

Catalog No.: ATL-HPA003734-100

Protein Description: Ras-related GTP binding A
Gene Name: RRAGA
Alternative Gene Name: FIP-1, RAGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041658: 99%, ENSRNOG00000050535: 99%
Entrez Gene ID: 10670
Uniprot ID: Q7L523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCF
• Gene Sequence: FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCF
• Gene ID - Mouse: ENSMUSG00000041658
• Gene ID - Rat: ENSRNOG00000050535
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.