Anti RPS6KL1 pAb (ATL-HPA027451 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027451-25

Protein Description: ribosomal protein S6 kinase-like 1
Gene Name: RPS6KL1
Alternative Gene Name: MGC11287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019235: 89%, ENSRNOG00000005530: 90%
Entrez Gene ID: 83694
Uniprot ID: Q9Y6S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP
• Gene Sequence: WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP
• Gene ID - Mouse: ENSMUSG00000019235
• Gene ID - Rat: ENSRNOG00000005530
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.