Anti RPS6KA2 pAb (ATL-HPA054237)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054237-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RPS6KA2
Alternative Gene Name: HU-2, RSK, RSK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023809: 88%, ENSRNOG00000013194: 88%
Entrez Gene ID: 6196
Uniprot ID: Q15349
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK |
| Gene Sequence | VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK |
| Gene ID - Mouse | ENSMUSG00000023809 |
| Gene ID - Rat | ENSRNOG00000013194 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS6KA2 pAb (ATL-HPA054237) | |
| Datasheet | Anti RPS6KA2 pAb (ATL-HPA054237) Datasheet (External Link) |
| Vendor Page | Anti RPS6KA2 pAb (ATL-HPA054237) at Atlas Antibodies |
| Documents & Links for Anti RPS6KA2 pAb (ATL-HPA054237) | |
| Datasheet | Anti RPS6KA2 pAb (ATL-HPA054237) Datasheet (External Link) |
| Vendor Page | Anti RPS6KA2 pAb (ATL-HPA054237) |