Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055878-100

• 
• 
• 

Protein Description: ribosomal protein S5
Gene Name: RPS5
Alternative Gene Name: S5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012848: 97%, ENSRNOG00000019453: 98%
Entrez Gene ID: 6193
Uniprot ID: P46782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA
• Gene Sequence: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA
• Gene ID - Mouse: ENSMUSG00000012848
• Gene ID - Rat: ENSRNOG00000019453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) – 1 Found

Mitterer, Valentin; Murat, Guillaume; Réty, Stéphane; Blaud, Magali; Delbos, Lila; Stanborough, Tamsyn; Bergler, Helmut; Leulliot, Nicolas; Kressler, Dieter; Pertschy, Brigitte. Sequential domain assembly of ribosomal protein S3 drives 40S subunit maturation. Nature Communications. 2016;7( 26831757):10336.