Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055878-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: RPS5
Alternative Gene Name: S5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012848: 97%, ENSRNOG00000019453: 98%
Entrez Gene ID: 6193
Uniprot ID: P46782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA |
| Gene Sequence | MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA |
| Gene ID - Mouse | ENSMUSG00000012848 |
| Gene ID - Rat | ENSRNOG00000019453 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) | |
| Datasheet | Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) | |
| Datasheet | Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) |
| Citations for Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) – 1 Found |
| Mitterer, Valentin; Murat, Guillaume; Réty, Stéphane; Blaud, Magali; Delbos, Lila; Stanborough, Tamsyn; Bergler, Helmut; Leulliot, Nicolas; Kressler, Dieter; Pertschy, Brigitte. Sequential domain assembly of ribosomal protein S3 drives 40S subunit maturation. Nature Communications. 2016;7( 26831757):10336. PubMed |