Anti RPS3 pAb (ATL-HPA063339)

Atlas Antibodies

Catalog No.:
ATL-HPA063339-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S3
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT
Gene Sequence NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT
Gene ID - Mouse ENSMUSG00000030744
Gene ID - Rat ENSRNOG00000017418
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS3 pAb (ATL-HPA063339)
Datasheet Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link)
Vendor Page Anti RPS3 pAb (ATL-HPA063339) at Atlas Antibodies

Documents & Links for Anti RPS3 pAb (ATL-HPA063339)
Datasheet Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link)
Vendor Page Anti RPS3 pAb (ATL-HPA063339)