Anti RPS27A pAb (ATL-HPA054087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054087-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RPS27A
Alternative Gene Name: S27A, Uba80, UBCEP80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020460: 98%, ENSRNOG00000034246: 98%
Entrez Gene ID: 6233
Uniprot ID: P62979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED |
| Gene Sequence | KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED |
| Gene ID - Mouse | ENSMUSG00000020460 |
| Gene ID - Rat | ENSRNOG00000034246 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS27A pAb (ATL-HPA054087) | |
| Datasheet | Anti RPS27A pAb (ATL-HPA054087) Datasheet (External Link) |
| Vendor Page | Anti RPS27A pAb (ATL-HPA054087) at Atlas Antibodies |
| Documents & Links for Anti RPS27A pAb (ATL-HPA054087) | |
| Datasheet | Anti RPS27A pAb (ATL-HPA054087) Datasheet (External Link) |
| Vendor Page | Anti RPS27A pAb (ATL-HPA054087) |