Anti RPS27A pAb (ATL-HPA054087)

Atlas Antibodies

Catalog No.:
ATL-HPA054087-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S27a
Gene Name: RPS27A
Alternative Gene Name: S27A, Uba80, UBCEP80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020460: 98%, ENSRNOG00000034246: 98%
Entrez Gene ID: 6233
Uniprot ID: P62979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED
Gene Sequence KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED
Gene ID - Mouse ENSMUSG00000020460
Gene ID - Rat ENSRNOG00000034246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS27A pAb (ATL-HPA054087)
Datasheet Anti RPS27A pAb (ATL-HPA054087) Datasheet (External Link)
Vendor Page Anti RPS27A pAb (ATL-HPA054087) at Atlas Antibodies

Documents & Links for Anti RPS27A pAb (ATL-HPA054087)
Datasheet Anti RPS27A pAb (ATL-HPA054087) Datasheet (External Link)
Vendor Page Anti RPS27A pAb (ATL-HPA054087)