Anti RPS25 pAb (ATL-HPA078683)

Atlas Antibodies

Catalog No.:
ATL-HPA078683-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S25
Gene Name: RPS25
Alternative Gene Name: S25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000027503: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE
Gene Sequence KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE
Gene ID - Mouse ENSMUSG00000009927
Gene ID - Rat ENSRNOG00000027503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS25 pAb (ATL-HPA078683)
Datasheet Anti RPS25 pAb (ATL-HPA078683) Datasheet (External Link)
Vendor Page Anti RPS25 pAb (ATL-HPA078683) at Atlas Antibodies

Documents & Links for Anti RPS25 pAb (ATL-HPA078683)
Datasheet Anti RPS25 pAb (ATL-HPA078683) Datasheet (External Link)
Vendor Page Anti RPS25 pAb (ATL-HPA078683)