Anti RPS23 pAb (ATL-HPA054853)

Atlas Antibodies

Catalog No.:
ATL-HPA054853-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S23
Gene Name: RPS23
Alternative Gene Name: S23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049517: 100%, ENSRNOG00000016580: 100%
Entrez Gene ID: 6228
Uniprot ID: P62266
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ
Gene Sequence CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ
Gene ID - Mouse ENSMUSG00000049517
Gene ID - Rat ENSRNOG00000016580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS23 pAb (ATL-HPA054853)
Datasheet Anti RPS23 pAb (ATL-HPA054853) Datasheet (External Link)
Vendor Page Anti RPS23 pAb (ATL-HPA054853) at Atlas Antibodies

Documents & Links for Anti RPS23 pAb (ATL-HPA054853)
Datasheet Anti RPS23 pAb (ATL-HPA054853) Datasheet (External Link)
Vendor Page Anti RPS23 pAb (ATL-HPA054853)