Anti RPS23 pAb (ATL-HPA054853)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054853-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: RPS23
Alternative Gene Name: S23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049517: 100%, ENSRNOG00000016580: 100%
Entrez Gene ID: 6228
Uniprot ID: P62266
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ |
| Gene Sequence | CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ |
| Gene ID - Mouse | ENSMUSG00000049517 |
| Gene ID - Rat | ENSRNOG00000016580 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS23 pAb (ATL-HPA054853) | |
| Datasheet | Anti RPS23 pAb (ATL-HPA054853) Datasheet (External Link) |
| Vendor Page | Anti RPS23 pAb (ATL-HPA054853) at Atlas Antibodies |
| Documents & Links for Anti RPS23 pAb (ATL-HPA054853) | |
| Datasheet | Anti RPS23 pAb (ATL-HPA054853) Datasheet (External Link) |
| Vendor Page | Anti RPS23 pAb (ATL-HPA054853) |