Anti RPS19 pAb (ATL-HPA063217)

Atlas Antibodies

Catalog No.:
ATL-HPA063217-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S19
Gene Name: RPS19
Alternative Gene Name: DBA, S19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040952: 96%, ENSRNOG00000048199: 96%
Entrez Gene ID: 6223
Uniprot ID: P39019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG
Gene Sequence LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG
Gene ID - Mouse ENSMUSG00000040952
Gene ID - Rat ENSRNOG00000048199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS19 pAb (ATL-HPA063217)
Datasheet Anti RPS19 pAb (ATL-HPA063217) Datasheet (External Link)
Vendor Page Anti RPS19 pAb (ATL-HPA063217) at Atlas Antibodies

Documents & Links for Anti RPS19 pAb (ATL-HPA063217)
Datasheet Anti RPS19 pAb (ATL-HPA063217) Datasheet (External Link)
Vendor Page Anti RPS19 pAb (ATL-HPA063217)