Anti RPS17 pAb (ATL-HPA055060)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055060-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: RPS17
Alternative Gene Name: MGC72007, RPS17L, RPS17L1, RPS17L2, S17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061787: 100%, ENSRNOG00000045885: 100%
Entrez Gene ID: 6218
Uniprot ID: P08708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL |
| Gene Sequence | RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL |
| Gene ID - Mouse | ENSMUSG00000061787 |
| Gene ID - Rat | ENSRNOG00000045885 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS17 pAb (ATL-HPA055060) | |
| Datasheet | Anti RPS17 pAb (ATL-HPA055060) Datasheet (External Link) |
| Vendor Page | Anti RPS17 pAb (ATL-HPA055060) at Atlas Antibodies |
| Documents & Links for Anti RPS17 pAb (ATL-HPA055060) | |
| Datasheet | Anti RPS17 pAb (ATL-HPA055060) Datasheet (External Link) |
| Vendor Page | Anti RPS17 pAb (ATL-HPA055060) |