Anti RPS16 pAb (ATL-HPA064222)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064222-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RPS16
Alternative Gene Name: S16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG |
| Gene Sequence | MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG |
| Gene ID - Mouse | ENSMUSG00000037563 |
| Gene ID - Rat | ENSRNOG00000019578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS16 pAb (ATL-HPA064222) | |
| Datasheet | Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link) |
| Vendor Page | Anti RPS16 pAb (ATL-HPA064222) at Atlas Antibodies |
| Documents & Links for Anti RPS16 pAb (ATL-HPA064222) | |
| Datasheet | Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link) |
| Vendor Page | Anti RPS16 pAb (ATL-HPA064222) |