Anti RPS16 pAb (ATL-HPA064222)

Atlas Antibodies

Catalog No.:
ATL-HPA064222-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S16
Gene Name: RPS16
Alternative Gene Name: S16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Gene Sequence MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Gene ID - Mouse ENSMUSG00000037563
Gene ID - Rat ENSRNOG00000019578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS16 pAb (ATL-HPA064222)
Datasheet Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link)
Vendor Page Anti RPS16 pAb (ATL-HPA064222) at Atlas Antibodies

Documents & Links for Anti RPS16 pAb (ATL-HPA064222)
Datasheet Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link)
Vendor Page Anti RPS16 pAb (ATL-HPA064222)