Anti RPS16 pAb (ATL-HPA064222)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064222-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPS16
Alternative Gene Name: S16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG |
Gene Sequence | MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG |
Gene ID - Mouse | ENSMUSG00000037563 |
Gene ID - Rat | ENSRNOG00000019578 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RPS16 pAb (ATL-HPA064222) | |
Datasheet | Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link) |
Vendor Page | Anti RPS16 pAb (ATL-HPA064222) at Atlas Antibodies |
Documents & Links for Anti RPS16 pAb (ATL-HPA064222) | |
Datasheet | Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link) |
Vendor Page | Anti RPS16 pAb (ATL-HPA064222) |