Anti RPS16 pAb (ATL-HPA064222)

Atlas Antibodies

SKU:
ATL-HPA064222-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S16
Gene Name: RPS16
Alternative Gene Name: S16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Gene Sequence MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Gene ID - Mouse ENSMUSG00000037563
Gene ID - Rat ENSRNOG00000019578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPS16 pAb (ATL-HPA064222)
Datasheet Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link)
Vendor Page Anti RPS16 pAb (ATL-HPA064222) at Atlas Antibodies

Documents & Links for Anti RPS16 pAb (ATL-HPA064222)
Datasheet Anti RPS16 pAb (ATL-HPA064222) Datasheet (External Link)
Vendor Page Anti RPS16 pAb (ATL-HPA064222)