Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA054510-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S15
Gene Name: RPS15
Alternative Gene Name: MGC111130, RIG, S15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063457: 100%, ENSRNOG00000024603: 100%
Entrez Gene ID: 6209
Uniprot ID: P62841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH
Gene Sequence MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH
Gene ID - Mouse ENSMUSG00000063457
Gene ID - Rat ENSRNOG00000024603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation)
Datasheet Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation)
Datasheet Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPS15 pAb (ATL-HPA054510 w/enhanced validation)