Anti RPS10 pAb (ATL-HPA047268)

Atlas Antibodies

Catalog No.:
ATL-HPA047268-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S10
Gene Name: RPS10
Alternative Gene Name: MGC88819, S10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052146: 98%, ENSRNOG00000000490: 98%
Entrez Gene ID: 6204
Uniprot ID: P46783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQF
Gene Sequence GVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQF
Gene ID - Mouse ENSMUSG00000052146
Gene ID - Rat ENSRNOG00000000490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS10 pAb (ATL-HPA047268)
Datasheet Anti RPS10 pAb (ATL-HPA047268) Datasheet (External Link)
Vendor Page Anti RPS10 pAb (ATL-HPA047268) at Atlas Antibodies

Documents & Links for Anti RPS10 pAb (ATL-HPA047268)
Datasheet Anti RPS10 pAb (ATL-HPA047268) Datasheet (External Link)
Vendor Page Anti RPS10 pAb (ATL-HPA047268)