Anti RPS10 pAb (ATL-HPA047268)

Atlas Antibodies

Catalog No.: ATL-HPA047268-25

Protein Description: ribosomal protein S10
Gene Name: RPS10
Alternative Gene Name: MGC88819, S10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052146: 98%, ENSRNOG00000000490: 98%
Entrez Gene ID: 6204
Uniprot ID: P46783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQF
• Gene Sequence: GVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQF
• Gene ID - Mouse: ENSMUSG00000052146
• Gene ID - Rat: ENSRNOG00000000490
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.