Anti RPRML pAb (ATL-HPA062668)

Atlas Antibodies

Catalog No.:
ATL-HPA062668-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: reprimo-like
Gene Name: RPRML
Alternative Gene Name: MGC43894
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046215: 76%, ENSRNOG00000028436: 76%
Entrez Gene ID: 388394
Uniprot ID: Q8N4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLNHSGLEEVDGVGGGAGAAMGNRTHGLGTWLGCCPG
Gene Sequence FLNHSGLEEVDGVGGGAGAAMGNRTHGLGTWLGCCPG
Gene ID - Mouse ENSMUSG00000046215
Gene ID - Rat ENSRNOG00000028436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPRML pAb (ATL-HPA062668)
Datasheet Anti RPRML pAb (ATL-HPA062668) Datasheet (External Link)
Vendor Page Anti RPRML pAb (ATL-HPA062668) at Atlas Antibodies

Documents & Links for Anti RPRML pAb (ATL-HPA062668)
Datasheet Anti RPRML pAb (ATL-HPA062668) Datasheet (External Link)
Vendor Page Anti RPRML pAb (ATL-HPA062668)