Anti RPRD2 pAb (ATL-HPA061693)

Atlas Antibodies

Catalog No.:
ATL-HPA061693-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: regulation of nuclear pre-mRNA domain containing 2
Gene Name: RPRD2
Alternative Gene Name: FLJ32145, HSPC099, KIAA0460
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028106: 91%, ENSRNOG00000054294: 94%
Entrez Gene ID: 23248
Uniprot ID: Q5VT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
Gene Sequence PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
Gene ID - Mouse ENSMUSG00000028106
Gene ID - Rat ENSRNOG00000054294
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPRD2 pAb (ATL-HPA061693)
Datasheet Anti RPRD2 pAb (ATL-HPA061693) Datasheet (External Link)
Vendor Page Anti RPRD2 pAb (ATL-HPA061693) at Atlas Antibodies

Documents & Links for Anti RPRD2 pAb (ATL-HPA061693)
Datasheet Anti RPRD2 pAb (ATL-HPA061693) Datasheet (External Link)
Vendor Page Anti RPRD2 pAb (ATL-HPA061693)