Anti RPRD1B pAb (ATL-HPA070590)

Atlas Antibodies

SKU: ATL-HPA070590-25

• 
• 

Protein Description: regulation of nuclear pre-mRNA domain containing 1B
Gene Name: RPRD1B
Alternative Gene Name: C20orf77, CREPT, dJ1057B20.2, DKFZp434P0735, FLJ44520, K-H, Kub5-Hera, NET60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027651: 97%, ENSRNOG00000012923: 97%
Entrez Gene ID: 58490
Uniprot ID: Q9NQG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK
• Gene Sequence: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK
• Gene ID - Mouse: ENSMUSG00000027651
• Gene ID - Rat: ENSRNOG00000012923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.