Anti RPP25L pAb (ATL-HPA059698)

Atlas Antibodies

Catalog No.:
ATL-HPA059698-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribonuclease P/MRP 25kDa subunit-like
Gene Name: RPP25L
Alternative Gene Name: bA296L22.5, C9orf23, MGC29635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036114: 94%, ENSRNOG00000059653: 94%
Entrez Gene ID: 138716
Uniprot ID: Q8N5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
Gene Sequence MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
Gene ID - Mouse ENSMUSG00000036114
Gene ID - Rat ENSRNOG00000059653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPP25L pAb (ATL-HPA059698)
Datasheet Anti RPP25L pAb (ATL-HPA059698) Datasheet (External Link)
Vendor Page Anti RPP25L pAb (ATL-HPA059698) at Atlas Antibodies

Documents & Links for Anti RPP25L pAb (ATL-HPA059698)
Datasheet Anti RPP25L pAb (ATL-HPA059698) Datasheet (External Link)
Vendor Page Anti RPP25L pAb (ATL-HPA059698)