Anti RPP25L pAb (ATL-HPA059698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059698-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RPP25L
Alternative Gene Name: bA296L22.5, C9orf23, MGC29635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036114: 94%, ENSRNOG00000059653: 94%
Entrez Gene ID: 138716
Uniprot ID: Q8N5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE |
Gene Sequence | MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE |
Gene ID - Mouse | ENSMUSG00000036114 |
Gene ID - Rat | ENSRNOG00000059653 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RPP25L pAb (ATL-HPA059698) | |
Datasheet | Anti RPP25L pAb (ATL-HPA059698) Datasheet (External Link) |
Vendor Page | Anti RPP25L pAb (ATL-HPA059698) at Atlas Antibodies |
Documents & Links for Anti RPP25L pAb (ATL-HPA059698) | |
Datasheet | Anti RPP25L pAb (ATL-HPA059698) Datasheet (External Link) |
Vendor Page | Anti RPP25L pAb (ATL-HPA059698) |