Anti RPLP2 pAb (ATL-HPA053635)

Atlas Antibodies

Catalog No.:
ATL-HPA053635-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein, large, P2
Gene Name: RPLP2
Alternative Gene Name: D11S2243E, LP2, MGC71408, P2, RPP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025508: 100%, ENSRNOG00000038074: 95%
Entrez Gene ID: 6181
Uniprot ID: P05387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
Gene Sequence MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
Gene ID - Mouse ENSMUSG00000025508
Gene ID - Rat ENSRNOG00000038074
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPLP2 pAb (ATL-HPA053635)
Datasheet Anti RPLP2 pAb (ATL-HPA053635) Datasheet (External Link)
Vendor Page Anti RPLP2 pAb (ATL-HPA053635) at Atlas Antibodies

Documents & Links for Anti RPLP2 pAb (ATL-HPA053635)
Datasheet Anti RPLP2 pAb (ATL-HPA053635) Datasheet (External Link)
Vendor Page Anti RPLP2 pAb (ATL-HPA053635)