Anti RPL7L1 pAb (ATL-HPA050478)

Atlas Antibodies

Catalog No.:
ATL-HPA050478-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L7-like 1
Gene Name: RPL7L1
Alternative Gene Name: dJ475N16.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063888: 88%, ENSRNOG00000016269: 93%
Entrez Gene ID: 285855
Uniprot ID: Q6DKI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN
Gene Sequence HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN
Gene ID - Mouse ENSMUSG00000063888
Gene ID - Rat ENSRNOG00000016269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL7L1 pAb (ATL-HPA050478)
Datasheet Anti RPL7L1 pAb (ATL-HPA050478) Datasheet (External Link)
Vendor Page Anti RPL7L1 pAb (ATL-HPA050478) at Atlas Antibodies

Documents & Links for Anti RPL7L1 pAb (ATL-HPA050478)
Datasheet Anti RPL7L1 pAb (ATL-HPA050478) Datasheet (External Link)
Vendor Page Anti RPL7L1 pAb (ATL-HPA050478)