Anti RPL7 pAb (ATL-HPA058373)

Atlas Antibodies

Catalog No.:
ATL-HPA058373-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L7
Gene Name: RPL7
Alternative Gene Name: humL7-1, L7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043716: 83%, ENSRNOG00000006992: 85%
Entrez Gene ID: 6129
Uniprot ID: P18124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
Gene Sequence VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
Gene ID - Mouse ENSMUSG00000043716
Gene ID - Rat ENSRNOG00000006992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL7 pAb (ATL-HPA058373)
Datasheet Anti RPL7 pAb (ATL-HPA058373) Datasheet (External Link)
Vendor Page Anti RPL7 pAb (ATL-HPA058373) at Atlas Antibodies

Documents & Links for Anti RPL7 pAb (ATL-HPA058373)
Datasheet Anti RPL7 pAb (ATL-HPA058373) Datasheet (External Link)
Vendor Page Anti RPL7 pAb (ATL-HPA058373)