Anti RPL7 pAb (ATL-HPA058373)

Atlas Antibodies

Catalog No.: ATL-HPA058373-100

Protein Description: ribosomal protein L7
Gene Name: RPL7
Alternative Gene Name: humL7-1, L7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043716: 83%, ENSRNOG00000006992: 85%
Entrez Gene ID: 6129
Uniprot ID: P18124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
• Gene Sequence: VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
• Gene ID - Mouse: ENSMUSG00000043716
• Gene ID - Rat: ENSRNOG00000006992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.