Anti RPL6 pAb (ATL-HPA068418)

Atlas Antibodies

Catalog No.:
ATL-HPA068418-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L6
Gene Name: RPL6
Alternative Gene Name: L6, TAXREB107, TXREB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029614: 94%, ENSRNOG00000031889: 94%
Entrez Gene ID: 6128
Uniprot ID: Q02878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF
Gene Sequence NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF
Gene ID - Mouse ENSMUSG00000029614
Gene ID - Rat ENSRNOG00000031889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL6 pAb (ATL-HPA068418)
Datasheet Anti RPL6 pAb (ATL-HPA068418) Datasheet (External Link)
Vendor Page Anti RPL6 pAb (ATL-HPA068418) at Atlas Antibodies

Documents & Links for Anti RPL6 pAb (ATL-HPA068418)
Datasheet Anti RPL6 pAb (ATL-HPA068418) Datasheet (External Link)
Vendor Page Anti RPL6 pAb (ATL-HPA068418)