Anti RPL6 pAb (ATL-HPA060903)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060903-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPL6
Alternative Gene Name: L6, TAXREB107, TXREB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029614: 94%, ENSRNOG00000031889: 94%
Entrez Gene ID: 6128
Uniprot ID: Q02878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF |
| Gene Sequence | NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF |
| Gene ID - Mouse | ENSMUSG00000029614 |
| Gene ID - Rat | ENSRNOG00000031889 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL6 pAb (ATL-HPA060903) | |
| Datasheet | Anti RPL6 pAb (ATL-HPA060903) Datasheet (External Link) |
| Vendor Page | Anti RPL6 pAb (ATL-HPA060903) at Atlas Antibodies |
| Documents & Links for Anti RPL6 pAb (ATL-HPA060903) | |
| Datasheet | Anti RPL6 pAb (ATL-HPA060903) Datasheet (External Link) |
| Vendor Page | Anti RPL6 pAb (ATL-HPA060903) |