Anti RPL5 pAb (ATL-HPA054444)

Atlas Antibodies

Catalog No.:
ATL-HPA054444-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L5
Gene Name: RPL5
Alternative Gene Name: L5, PPP1R135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058558: 98%, ENSRNOG00000023529: 98%
Entrez Gene ID: 6125
Uniprot ID: P46777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAE
Gene Sequence RKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAE
Gene ID - Mouse ENSMUSG00000058558
Gene ID - Rat ENSRNOG00000023529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL5 pAb (ATL-HPA054444)
Datasheet Anti RPL5 pAb (ATL-HPA054444) Datasheet (External Link)
Vendor Page Anti RPL5 pAb (ATL-HPA054444) at Atlas Antibodies

Documents & Links for Anti RPL5 pAb (ATL-HPA054444)
Datasheet Anti RPL5 pAb (ATL-HPA054444) Datasheet (External Link)
Vendor Page Anti RPL5 pAb (ATL-HPA054444)