Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA049136-25

Protein Description: ribosomal protein L3-like
Gene Name: RPL3L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002500: 85%, ENSRNOG00000014641: 88%
Entrez Gene ID: 6123
Uniprot ID: Q92901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
• Gene Sequence: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
• Gene ID - Mouse: ENSMUSG00000002500
• Gene ID - Rat: ENSRNOG00000014641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.