Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049136-25
  • Immunohistochemistry analysis in human skeletal muscle and prostate tissues using HPA049136 antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L3-like
Gene Name: RPL3L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002500: 85%, ENSRNOG00000014641: 88%
Entrez Gene ID: 6123
Uniprot ID: Q92901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
Gene Sequence GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
Gene ID - Mouse ENSMUSG00000002500
Gene ID - Rat ENSRNOG00000014641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation)
Datasheet Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation)
Datasheet Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPL3L pAb (ATL-HPA049136 w/enhanced validation)