Anti RPL37A pAb (ATL-HPA065327)

Atlas Antibodies

Catalog No.:
ATL-HPA065327-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L37a
Gene Name: RPL37A
Alternative Gene Name: L37A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046330: 98%, ENSRNOG00000023385: 96%
Entrez Gene ID: 6168
Uniprot ID: P61513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Gene Sequence KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Gene ID - Mouse ENSMUSG00000046330
Gene ID - Rat ENSRNOG00000023385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL37A pAb (ATL-HPA065327)
Datasheet Anti RPL37A pAb (ATL-HPA065327) Datasheet (External Link)
Vendor Page Anti RPL37A pAb (ATL-HPA065327) at Atlas Antibodies

Documents & Links for Anti RPL37A pAb (ATL-HPA065327)
Datasheet Anti RPL37A pAb (ATL-HPA065327) Datasheet (External Link)
Vendor Page Anti RPL37A pAb (ATL-HPA065327)