Anti RPL36A pAb (ATL-HPA077586)

Atlas Antibodies

Catalog No.:
ATL-HPA077586-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L36a
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079435: 100%, ENSRNOG00000011494: 100%
Entrez Gene ID: 6173
Uniprot ID: P83881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
Gene Sequence MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
Gene ID - Mouse ENSMUSG00000079435
Gene ID - Rat ENSRNOG00000011494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL36A pAb (ATL-HPA077586)
Datasheet Anti RPL36A pAb (ATL-HPA077586) Datasheet (External Link)
Vendor Page Anti RPL36A pAb (ATL-HPA077586) at Atlas Antibodies

Documents & Links for Anti RPL36A pAb (ATL-HPA077586)
Datasheet Anti RPL36A pAb (ATL-HPA077586) Datasheet (External Link)
Vendor Page Anti RPL36A pAb (ATL-HPA077586)