Anti RPL36A pAb (ATL-HPA063979)

Atlas Antibodies

SKU:
ATL-HPA063979-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L36a
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095693: 37%, ENSRNOG00000014901: 40%
Entrez Gene ID: 6173
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIAPTDSHEEVRSGTSYILPFASRFLSFRA
Gene Sequence MIAPTDSHEEVRSGTSYILPFASRFLSFRA
Gene ID - Mouse ENSMUSG00000095693
Gene ID - Rat ENSRNOG00000014901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPL36A pAb (ATL-HPA063979)
Datasheet Anti RPL36A pAb (ATL-HPA063979) Datasheet (External Link)
Vendor Page Anti RPL36A pAb (ATL-HPA063979) at Atlas Antibodies

Documents & Links for Anti RPL36A pAb (ATL-HPA063979)
Datasheet Anti RPL36A pAb (ATL-HPA063979) Datasheet (External Link)
Vendor Page Anti RPL36A pAb (ATL-HPA063979)



Citations for Anti RPL36A pAb (ATL-HPA063979) – 1 Found
Zhang, Zhiyuan; Wu, Qi; Fang, Meimiao; Liu, Yu; Jiang, Ji; Feng, Qingyang; Hu, Ronggui; Xu, Jianmin. HERC3 directly targets RPL23A for ubiquitination degradation and further regulates Colorectal Cancer proliferation and the cell cycle. International Journal Of Biological Sciences. 18(8):3282-3297.  PubMed