Anti RPL28 pAb (ATL-HPA050459 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050459-25

Protein Description: ribosomal protein L28
Gene Name: RPL28
Alternative Gene Name: FLJ43307, L28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030432: 98%, ENSRNOG00000017127: 98%
Entrez Gene ID: 6158
Uniprot ID: P46779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
• Gene Sequence: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
• Gene ID - Mouse: ENSMUSG00000030432
• Gene ID - Rat: ENSRNOG00000017127
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.